PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_5337_iso_6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 396aa    MW: 44442.4 Da    PI: 5.988
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_5337_iso_6genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.41.4e-091291661954
                                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                          Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  cra_locus_5337_iso_6_len_1847_ver_3 129 FEHflHPYPKDSDKIMLARQTGLTRSQVSNWFINARVR 166
                                          665559******************************88 PP

2BELL96.81.8e-316621672
                                 BELL 16 leeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
                                         l +V++rYkqy++q+q+v+ssF+ +ag g++kpYt+lAl++iSrhFrcL+dai+eq+
  cra_locus_5337_iso_6_len_1847_ver_3  6 LSQVERRYKQYYHQMQIVVSSFDGIAGPGASKPYTALALQTISRHFRCLRDAISEQV 62
                                         579****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.4E-5160IPR006563POX domain
PfamPF075263.7E-26659IPR006563POX domain
PROSITE profilePS5007112.115107170IPR001356Homeobox domain
SMARTSM003891.6E-9110174IPR001356Homeobox domain
CDDcd000861.65E-12110171No hitNo description
SuperFamilySSF466891.28E-17111177IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.4E-29113176IPR009057Homeodomain-like
PfamPF059202.3E-18127166IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 396 aa     Download sequence    Send to blast
MTSIGLSQVE RRYKQYYHQM QIVVSSFDGI AGPGASKPYT ALALQTISRH FRCLRDAISE  60
QVQVTRKSLG DQDASENSKG VGISRLRYVD QQIRQQRALQ QLGMMQQHAW RPQRGLPETS  120
VSILRAWLFE HFLHPYPKDS DKIMLARQTG LTRSQVSNWF INARVRLWKP MVEEMYKEEI  180
GDGEMDINSP SELATKATNS EAKDSEDRAA EDLQQSTTST PTERCSTGQF FESRSDHFAD  240
VELMEPNIDQ AYQNLNHTET ENEYGLGKSR SGSRRPEMND CSFLPETTIV HQSNEGSHRL  300
MAAAAAYHMS ELERFENGNG GVSLTLGLQQ CEGTNVAMSI GTHQGYVAMR GDTIYTTAAA  360
ASMVSEGTDQ FDIMDTGNHV SHQRFGSSHL LHDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A7e-17116174563Homeobox protein Meis2
3k2a_B7e-17116174563Homeobox protein Meis2
4xrs_A7e-17116173158Homeobox protein Meis1
4xrs_B7e-17116173158Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015892487.11e-178PREDICTED: BEL1-like homeodomain protein 6
SwissprotO656851e-104BLH6_ARATH; BEL1-like homeodomain protein 6
TrEMBLA0A061DZU51e-176A0A061DZU5_THECC; BEL1-like homeodomain protein 6 isoform 1
STRINGVIT_03s0038g00050.t011e-170(Vitis vinifera)
STRINGPOPTR_0009s12360.11e-170(Populus trichocarpa)